Lineage for d2lnta1 (2lnt A:41-175)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879614Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2879896Domain d2lnta1: 2lnt A:41-175 [242947]
    Other proteins in same PDB: d2lnta2
    automated match to d3ph9b_
    mutant

Details for d2lnta1

PDB Entry: 2lnt (more details)

PDB Description: Solution structure of E60A mutant AGR2
PDB Compounds: (A:) Anterior gradient protein 2 homolog

SCOPe Domain Sequences for d2lnta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lnta1 c.47.1.0 (A:41-175) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqtlsrgwgdqliwtqtyeaalyksktsnkplmiihhldecphsqalkkvfaenkeiqkl
aeqfvllnlvyettdkhlspdgqyvprimfvdpsltvraditgrysnrlyayepadtall
ldnmkkalkllktel

SCOPe Domain Coordinates for d2lnta1:

Click to download the PDB-style file with coordinates for d2lnta1.
(The format of our PDB-style files is described here.)

Timeline for d2lnta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lnta2