Lineage for d2lnsb_ (2lns B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602752Species Human (Homo sapiens) [TaxId:9606] [188013] (91 PDB entries)
  8. 1602953Domain d2lnsb_: 2lns B: [242946]
    automated match to d3ph9b_

Details for d2lnsb_

PDB Entry: 2lns (more details)

PDB Description: Solution structure of AGR2 residues 41-175
PDB Compounds: (B:) Anterior gradient protein 2 homolog

SCOPe Domain Sequences for d2lnsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lnsb_ c.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
idpftpqtlsrgwgdqliwtqtyeealyksktsnkplmiihhldecphsqalkkvfaenk
eiqklaeqfvllnlvyettdkhlspdgqyvprimfvdpsltvraditgrysnrlyayepa
dtallldnmkkalkllktel

SCOPe Domain Coordinates for d2lnsb_:

Click to download the PDB-style file with coordinates for d2lnsb_.
(The format of our PDB-style files is described here.)

Timeline for d2lnsb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2lnsa_