SCOPe 2.06: Domain d2lnia1: 2lni A:12-133

Lineage for d2lnia1 (2lni A:12-133)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255451] (7 PDB entries)

8. Domain d2lnia1: 2lni A:12-133 [242944]
   Other proteins in same PDB: d2lnia2
   automated match to d4gcoa_

Details for d2lnia1

PDB Entry: 2lni

PDB Description: Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4403E

PDB Compounds: (A:) Stress-induced-phosphoprotein 1

SCOPe Domain Sequences for d2lnia1:

Sequence; same for both SEQRES and ATOM records:

>d2lnia1 a.118.8.0 (A:12-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npdlalmvknkgnecfqkgdypqamkhyteaikrnpkdaklysnraacytkllefqlalk
dceeciqleptfikgytrkaaaleamkdytkamdvyqkaldldssckeaadgyqrcmmaq
yn

Timeline for d2lnia1:

• d2lnia1 first appeared in SCOPe 2.04, called d2lnia_
  
• d2lnia1 was called d2lnia_ in SCOPe 2.05
  
• d2lnia1 appears in SCOPe 2.07
  
• d2lnia1 appears in the current release, SCOPe 2.08