SCOPe 2.04: Domain d2lnia_: 2lni A:

Lineage for d2lnia_ (2lni A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.0: automated matches [191581] (1 protein)
   not a true family

6. Protein automated matches [191037] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255451] (1 PDB entry)

8. Domain d2lnia_: 2lni A: [242944]
   automated match to d4gcoa_

Details for d2lnia_

PDB Entry: 2lni

PDB Description: Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4403E

PDB Compounds: (A:) Stress-induced-phosphoprotein 1

SCOPe Domain Sequences for d2lnia_:

Sequence; same for both SEQRES and ATOM records:

>d2lnia_ a.118.8.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mghhhhhhshmnpdlalmvknkgnecfqkgdypqamkhyteaikrnpkdaklysnraacy
tkllefqlalkdceeciqleptfikgytrkaaaleamkdytkamdvyqkaldldssckea
adgyqrcmmaqyn

Timeline for d2lnia_:

• d2lnia_ is new in SCOPe 2.04-stable
  
• d2lnia_ appears in SCOPe 2.05
  
• d2lnia_ appears in the current release, SCOPe 2.08, called d2lnia1