| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
| Family a.118.8.0: automated matches [191581] (1 protein) not a true family |
| Protein automated matches [191037] (12 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255451] (15 PDB entries) |
| Domain d2lnia1: 2lni A:12-133 [242944] Other proteins in same PDB: d2lnia2 automated match to d4gcoa_ |
PDB Entry: 2lni (more details)
SCOPe Domain Sequences for d2lnia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lnia1 a.118.8.0 (A:12-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npdlalmvknkgnecfqkgdypqamkhyteaikrnpkdaklysnraacytkllefqlalk
dceeciqleptfikgytrkaaaleamkdytkamdvyqkaldldssckeaadgyqrcmmaq
yn
Timeline for d2lnia1: