Lineage for d2lnia1 (2lni A:12-133)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333768Superfamily a.118.8: TPR-like [48452] (10 families) (S)
  5. 2334081Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 2334082Protein automated matches [191037] (12 species)
    not a true protein
  7. 2334109Species Human (Homo sapiens) [TaxId:9606] [255451] (7 PDB entries)
  8. 2334122Domain d2lnia1: 2lni A:12-133 [242944]
    Other proteins in same PDB: d2lnia2
    automated match to d4gcoa_

Details for d2lnia1

PDB Entry: 2lni (more details)

PDB Description: Solution NMR Structure of Stress-induced-phosphoprotein 1 STI1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4403E
PDB Compounds: (A:) Stress-induced-phosphoprotein 1

SCOPe Domain Sequences for d2lnia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lnia1 a.118.8.0 (A:12-133) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npdlalmvknkgnecfqkgdypqamkhyteaikrnpkdaklysnraacytkllefqlalk
dceeciqleptfikgytrkaaaleamkdytkamdvyqkaldldssckeaadgyqrcmmaq
yn

SCOPe Domain Coordinates for d2lnia1:

Click to download the PDB-style file with coordinates for d2lnia1.
(The format of our PDB-style files is described here.)

Timeline for d2lnia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lnia2