Lineage for d2lnhb_ (2lnh B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536478Protein automated matches [190043] (6 species)
    not a true protein
  7. 1536503Species Human (Homo sapiens) [TaxId:9606] [187799] (23 PDB entries)
  8. 1536528Domain d2lnhb_: 2lnh B: [242943]
    automated match to d3rnja_

Details for d2lnhb_

PDB Entry: 2lnh (more details)

PDB Description: Enterohaemorrhagic E. coli (EHEC) exploits a tryptophan switch to hijack host F-actin assembly
PDB Compounds: (B:) Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1

SCOPe Domain Sequences for d2lnhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lnhb_ b.34.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmkkqkvktifphtagsnktllsfaqgdvitllipeekdgwlygehdvskargwfpss
ytkllee

SCOPe Domain Coordinates for d2lnhb_:

Click to download the PDB-style file with coordinates for d2lnhb_.
(The format of our PDB-style files is described here.)

Timeline for d2lnhb_: