SCOPe 2.08: Domain d2lnhb1: 2lnh B:69-132

Lineage for d2lnhb1 (2lnh B:69-132)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein automated matches [190043] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)

8. Domain d2lnhb1: 2lnh B:69-132 [242943]
   Other proteins in same PDB: d2lnhb2
   automated match to d3rnja_

Details for d2lnhb1

PDB Entry: 2lnh

PDB Description: Enterohaemorrhagic E. coli (EHEC) exploits a tryptophan switch to hijack host F-actin assembly

PDB Compounds: (B:) Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1

SCOPe Domain Sequences for d2lnhb1:

Sequence; same for both SEQRES and ATOM records:

>d2lnhb1 b.34.2.1 (B:69-132) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkkqkvktifphtagsnktllsfaqgdvitllipeekdgwlygehdvskargwfpssytk
llee

Timeline for d2lnhb1:

• d2lnhb1 first appeared in SCOPe 2.04, called d2lnhb_
  
• d2lnhb1 appears in SCOPe 2.07