Lineage for d2lnba1 (2lnb A:12-80)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694784Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries)
  8. 2694837Domain d2lnba1: 2lnb A:12-80 [242942]
    Other proteins in same PDB: d2lnba2
    automated match to d1j75a_

Details for d2lnba1

PDB Entry: 2lnb (more details)

PDB Description: Solution NMR structure of N-terminal domain (6-74) of human ZBP1 protein, Northeast Structural Genomics Consortium Target HR8174A.
PDB Compounds: (A:) Z-DNA-binding protein 1

SCOPe Domain Sequences for d2lnba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lnba1 a.4.5.0 (A:12-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adpgreghleqrilqvlteagspvklaqlvkecqapkrelnqvlyrmkkelkvsltspat
wclggtdpe

SCOPe Domain Coordinates for d2lnba1:

Click to download the PDB-style file with coordinates for d2lnba1.
(The format of our PDB-style files is described here.)

Timeline for d2lnba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lnba2