Lineage for d4ovwa_ (4ovw A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781267Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 1781268Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)
  7. 1781272Species Fungus (Fusarium oxysporum) [TaxId:5507] [49976] (4 PDB entries)
  8. 1781275Domain d4ovwa_: 4ovw A: [24294]
    complexed with in1, nag

Details for d4ovwa_

PDB Entry: 4ovw (more details), 2.3 Å

PDB Description: endoglucanase i complexed with epoxybutyl cellobiose
PDB Compounds: (A:) endoglucanase I

SCOPe Domain Sequences for d4ovwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ovwa_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
etpdkakeqhpkletyrctkasgckkqtnyivadagihgirqkngagcgdwgqkpnatac
pdeascakncilsgmdsnayknagittsgnklrlqqlinnqlvsprvylleenkkkyeml
hltgtefsfdvemeklpcgmngalylsempqdggkstsrnskagayygagycdaqcyvtp
fingvgnikgqgvccneldiweansrathiaphpcskpglygctgdecgssgicdkagcg
wnhnrinvtdfygrgkqykvdstrkftvtsqfvankqgdlielhrhyiqdnkviesavvn
isgppkinfindkycaatganeymrlggtkqmgdamsrgmvlamsvwwsegdfmawldqg
vagpcdategdpknivkvqpnpevtfsnirigeigstssv

SCOPe Domain Coordinates for d4ovwa_:

Click to download the PDB-style file with coordinates for d4ovwa_.
(The format of our PDB-style files is described here.)

Timeline for d4ovwa_: