Lineage for d2lmsa_ (2lms A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1730528Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1730529Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1730819Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
    contains an additional helix in one of the crossover connections
  6. 1730820Protein Interferon-alpha 2a [47314] (1 species)
  7. 1730821Species Human (Homo sapiens) [TaxId:9606] [47315] (7 PDB entries)
  8. 1730836Domain d2lmsa_: 2lms A: [242938]
    automated match to d1itfa_
    complexed with a2g

Details for d2lmsa_

PDB Entry: 2lms (more details)

PDB Description: a single galnac residue on threonine-106 modifies the dynamics and the structure of interferon alpha-2a around the glycosylation site
PDB Compounds: (A:) Interferon alpha-2

SCOPe Domain Sequences for d2lmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lmsa_ a.26.1.3 (A:) Interferon-alpha 2a {Human (Homo sapiens) [TaxId: 9606]}
cdlpqthslgsrrtlmllaqmrkislfsclkdrhdfgfpqeefgnqfqkaetipvlhemi
qqifnlfstkdssaawdetlldkfytelyqqlndleacviqgvgvtetplmkedsilavr
kyfqritlylkekkyspcawevvraeimrsfslstnlqeslrske

SCOPe Domain Coordinates for d2lmsa_:

Click to download the PDB-style file with coordinates for d2lmsa_.
(The format of our PDB-style files is described here.)

Timeline for d2lmsa_: