| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.0: automated matches [191306] (1 protein) not a true family |
| Protein automated matches [190031] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries) |
| Domain d2lmra1: 2lmr A:22-101 [242937] Other proteins in same PDB: d2lmra2 automated match to d1v38a_ |
PDB Entry: 2lmr (more details)
SCOPe Domain Sequences for d2lmra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lmra1 a.60.1.0 (A:22-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isglrtleqsvgewlesiglqqyesklllngfddvhflgsnvmeeqdlrdigisdpqhrr
kllqaarslpkvkalgydgn
Timeline for d2lmra1: