SCOPe 2.08: Domain d2lmra1: 2lmr A:22-101

Lineage for d2lmra1 (2lmr A:22-101)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)

8. Domain d2lmra1: 2lmr A:22-101 [242937]
   Other proteins in same PDB: d2lmra2
   automated match to d1v38a_

Details for d2lmra1

PDB Entry: 2lmr

PDB Description: Solution structure of the first sam domain of odin

PDB Compounds: (A:) Ankyrin repeat and SAM domain-containing protein 1A

SCOPe Domain Sequences for d2lmra1:

Sequence; same for both SEQRES and ATOM records:

>d2lmra1 a.60.1.0 (A:22-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isglrtleqsvgewlesiglqqyesklllngfddvhflgsnvmeeqdlrdigisdpqhrr
kllqaarslpkvkalgydgn

Timeline for d2lmra1:

• d2lmra1 first appeared in SCOPe 2.04, called d2lmra_
  
• d2lmra1 appears in SCOPe 2.07