SCOPe 2.06: Domain d2lmda1: 2lmd A:12-174

Lineage for d2lmda1 (2lmd A:12-174)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein automated matches [190360] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)

8. Domain d2lmda1: 2lmd A:12-174 [242934]
   Other proteins in same PDB: d2lmda2
   automated match to d1xpxa_

Details for d2lmda1

PDB Entry: 2lmd

PDB Description: Minimal Constraints Solution NMR Structure of Prospero Homeobox protein 1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4660B

PDB Compounds: (A:) Prospero homeobox protein 1

SCOPe Domain Sequences for d2lmda1:

Sequence; same for both SEQRES and ATOM records:

>d2lmda1 a.4.1.1 (A:12-174) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amqeglspnhlkkaklmffytrypssnmlktyfsdvkfnrcitsqlikwfsnfrefyyiq
mekyarqaindgvtsteelsitrdcelyralnmhynkandfevperflevaqitlreffn
aiiagkdvdpswkkaiykvickldsevpeifkspnclqellhe

Timeline for d2lmda1:

• d2lmda1 first appeared in SCOPe 2.04, called d2lmda_
  
• d2lmda1 was called d2lmda_ in SCOPe 2.05
  
• d2lmda1 appears in SCOPe 2.07
  
• d2lmda1 appears in the current release, SCOPe 2.08