Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein automated matches [190360] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries) |
Domain d2lmda1: 2lmd A:12-174 [242934] Other proteins in same PDB: d2lmda2 automated match to d1xpxa_ |
PDB Entry: 2lmd (more details)
SCOPe Domain Sequences for d2lmda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lmda1 a.4.1.1 (A:12-174) automated matches {Human (Homo sapiens) [TaxId: 9606]} amqeglspnhlkkaklmffytrypssnmlktyfsdvkfnrcitsqlikwfsnfrefyyiq mekyarqaindgvtsteelsitrdcelyralnmhynkandfevperflevaqitlreffn aiiagkdvdpswkkaiykvickldsevpeifkspnclqellhe
Timeline for d2lmda1: