Lineage for d2lmda1 (2lmd A:12-174)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2691779Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2691970Protein automated matches [190360] (3 species)
    not a true protein
  7. 2691983Species Human (Homo sapiens) [TaxId:9606] [188758] (10 PDB entries)
  8. 2691993Domain d2lmda1: 2lmd A:12-174 [242934]
    Other proteins in same PDB: d2lmda2
    automated match to d1xpxa_

Details for d2lmda1

PDB Entry: 2lmd (more details)

PDB Description: Minimal Constraints Solution NMR Structure of Prospero Homeobox protein 1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4660B
PDB Compounds: (A:) Prospero homeobox protein 1

SCOPe Domain Sequences for d2lmda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lmda1 a.4.1.1 (A:12-174) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amqeglspnhlkkaklmffytrypssnmlktyfsdvkfnrcitsqlikwfsnfrefyyiq
mekyarqaindgvtsteelsitrdcelyralnmhynkandfevperflevaqitlreffn
aiiagkdvdpswkkaiykvickldsevpeifkspnclqellhe

SCOPe Domain Coordinates for d2lmda1:

Click to download the PDB-style file with coordinates for d2lmda1.
(The format of our PDB-style files is described here.)

Timeline for d2lmda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lmda2