Lineage for d2lm3a_ (2lm3 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782108Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226434] (2 PDB entries)
  8. 1782110Domain d2lm3a_: 2lm3 A: [242932]
    automated match to d2voka_

Details for d2lm3a_

PDB Entry: 2lm3 (more details)

PDB Description: Structure of the rhesus monkey TRIM5alpha PRYSPRY domain
PDB Compounds: (A:) Tripartite motif-containing protein 5

SCOPe Domain Sequences for d2lm3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lm3a_ b.29.1.0 (A:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
teltdarrywvdvtlatnnishaviaedkrqvssrnpqimyqapgtlftfpsltnfnyct
gvlgsqsitsgkhywevdvskksawilgvcagfqsdamynieqnenyqpkygywviglqe
gvkysvfqdgsshtpfapfivplsviicpdrvgvfvdyeactvsffnitnhgfliykfsq
csfskpvfpylnprkctvpmtlcsp

SCOPe Domain Coordinates for d2lm3a_:

Click to download the PDB-style file with coordinates for d2lm3a_.
(The format of our PDB-style files is described here.)

Timeline for d2lm3a_: