Lineage for d2llaa1 (2lla A:1490-1628)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807135Fold b.64: Mannose 6-phosphate receptor domain [50910] (1 superfamily)
    barrel, partly open; n*=8, S*=10; one psi loop
  4. 2807136Superfamily b.64.1: Mannose 6-phosphate receptor domain [50911] (1 family) (S)
  5. 2807137Family b.64.1.1: Mannose 6-phosphate receptor domain [50912] (3 proteins)
  6. 2807195Protein automated matches [254500] (3 species)
    not a true protein
  7. 2807196Species Australian echidna (Tachyglossus aculeatus) [TaxId:9261] [255446] (1 PDB entry)
  8. 2807197Domain d2llaa1: 2lla A:1490-1628 [242922]
    Other proteins in same PDB: d2llaa2
    automated match to d1e6fb_

Details for d2llaa1

PDB Entry: 2lla (more details)

PDB Description: NMR solution structure ensemble of domain 11 of the echidna M6P/IGF2R receptor
PDB Compounds: (A:) Mannose-6-phosphate/insulin-like growth factor II receptor

SCOPe Domain Sequences for d2llaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2llaa1 b.64.1.1 (A:1490-1628) automated matches {Australian echidna (Tachyglossus aculeatus) [TaxId: 9261]}
vqdncqvtnpatgyvfdlnslkresgytisdirkgsirlgvcgevkdcgpgigacfegtg
ikagkwnqklsyvdqvlqlvyedgdpcpanlhlkyksvisfvcksdagptsqplllsvde
htctlffswhtslaceqev

SCOPe Domain Coordinates for d2llaa1:

Click to download the PDB-style file with coordinates for d2llaa1.
(The format of our PDB-style files is described here.)

Timeline for d2llaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2llaa2