SCOPe 2.06: Domain d2lk4a_: 2lk4 A:

Lineage for d2lk4a_ (2lk4 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families)

5. Family a.24.14.0: automated matches [191584] (1 protein)
   not a true family

6. Protein automated matches [191041] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188873] (4 PDB entries)

8. Domain d2lk4a_: 2lk4 A: [242907]
   automated match to d3gm1a_

Details for d2lk4a_

PDB Entry: 2lk4

PDB Description: Structural and mechanistic insights into the interaction between PAT Pyk2 and Paxillin LD motif

PDB Compounds: (A:) Protein-tyrosine kinase 2-beta

SCOPe Domain Sequences for d2lk4a_:

Sequence; same for both SEQRES and ATOM records:

>d2lk4a_ a.24.14.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
anldrtddlvylnvmelvravlelknelsqlppegyvvvvknvgltlrkligsvddllps
lpsssrteiegtqkllnkdlaelinkmrlaqqnavtslseeakrqmltashtlavdaknl
ldavdqakvlanlah

Timeline for d2lk4a_:

• d2lk4a_ first appeared in SCOPe 2.04
  
• d2lk4a_ appears in SCOPe 2.05
  
• d2lk4a_ appears in SCOPe 2.07
  
• d2lk4a_ appears in the current release, SCOPe 2.08