SCOPe 2.06: Domain d2ljza1: 2ljz A:80-151

Lineage for d2ljza1 (2ljz A:80-151)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.90: E6 C-terminal domain-like [161228] (1 superfamily)
   alpha+beta zinc-binding fold with topological similarity to the fold of lambda cro protein

4. Superfamily g.90.1: E6 C-terminal domain-like [161229] (1 family)
   automatically mapped to Pfam PF00518

5. Family g.90.1.1: E6 C-terminal domain-like [161230] (2 proteins)
   C-terminal part of Pfam PF00518

6. Protein automated matches [254600] (2 species)
   not a true protein

7. Species Human papillomavirus [TaxId:333760] [255444] (1 PDB entry)

8. Domain d2ljza1: 2ljz A:80-151 [242906]
   Other proteins in same PDB: d2ljza2
   automated match to d2fk4a1
   complexed with zn

Details for d2ljza1

PDB Entry: 2ljz

PDB Description: Structure of the C-terminal domain of HPV16 E6 oncoprotein

PDB Compounds: (A:) Protein E6

SCOPe Domain Sequences for d2ljza1:

Sequence; same for both SEQRES and ATOM records:

>d2ljza1 g.90.1.1 (A:80-151) automated matches {Human papillomavirus [TaxId: 333760]}
syslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrcmsc
srssrtrretql

Timeline for d2ljza1:

• d2ljza1 first appeared in SCOPe 2.04, called d2ljza_
  
• d2ljza1 was called d2ljza_ in SCOPe 2.05
  
• d2ljza1 appears in SCOPe 2.07
  
• d2ljza1 appears in the current release, SCOPe 2.08