SCOPe 2.05: Domain d2ljza_: 2ljz A:

Lineage for d2ljza_ (2ljz A:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.90: E6 C-terminal domain-like [161228] (1 superfamily)
   alpha+beta zinc-binding fold with topological similarity to the fold of lambda cro protein

4. Superfamily g.90.1: E6 C-terminal domain-like [161229] (1 family)
   automatically mapped to Pfam PF00518

5. Family g.90.1.1: E6 C-terminal domain-like [161230] (2 proteins)
   C-terminal part of Pfam PF00518

6. Protein automated matches [254600] (2 species)
   not a true protein

7. Species Human papillomavirus [TaxId:333760] [255444] (1 PDB entry)

8. Domain d2ljza_: 2ljz A: [242906]
   automated match to d2fk4a1
   complexed with zn

Details for d2ljza_

PDB Entry: 2ljz

PDB Description: Structure of the C-terminal domain of HPV16 E6 oncoprotein

PDB Compounds: (A:) Protein E6

SCOPe Domain Sequences for d2ljza_:

Sequence; same for both SEQRES and ATOM records:

>d2ljza_ g.90.1.1 (A:) automated matches {Human papillomavirus [TaxId: 333760]}
gamsyslygttleqqynkplsdllircincqkplspeekqrhldkkqrfhnirgrwtgrc
mscsrssrtrretql

Timeline for d2ljza_:

• d2ljza_ first appeared in SCOPe 2.04
  
• d2ljza_ is called d2ljza1 in SCOPe 2.06
  
• d2ljza_ appears in the current release, SCOPe 2.08, called d2ljza1