Lineage for d2ljha_ (2ljh A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170232Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2170233Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2170416Family d.50.1.0: automated matches [254259] (1 protein)
    not a true family
  6. 2170417Protein automated matches [254599] (1 species)
    not a true protein
  7. 2170418Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255442] (1 PDB entry)
  8. 2170419Domain d2ljha_: 2ljh A: [242902]
    automated match to d2dmya1

Details for d2ljha_

PDB Entry: 2ljh (more details)

PDB Description: NMR structure of Double-stranded RNA-specific editase Adar
PDB Compounds: (A:) Double-stranded RNA-specific editase Adar

SCOPe Domain Sequences for d2ljha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ljha_ d.50.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdpkkkmckeripqpkntvamlnelrhgliyklesqtgpvhaplftisvevdgqkylgqg
rskkvarieaaatalrsfiqfkdgavlsplkpa

SCOPe Domain Coordinates for d2ljha_:

Click to download the PDB-style file with coordinates for d2ljha_.
(The format of our PDB-style files is described here.)

Timeline for d2ljha_: