SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2ljha_ (2ljh A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2170232Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 2170233Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. 2170416Family d.50.1.0: automated matches [254259] (1 protein)
    not a true family
  6. 2170417Protein automated matches [254599] (1 species)
    not a true protein
  7. 2170418Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255442] (1 PDB entry)
  8. 2170419Domain d2ljha_: 2ljh A: [242902]
    automated match to d2dmya1

Details for d2ljha_

PDB Entry: 2ljh (more details)

PDB Description: NMR structure of Double-stranded RNA-specific editase Adar
PDB Compounds: (A:) Double-stranded RNA-specific editase Adar

SCOPe Domain Sequences for d2ljha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ljha_ d.50.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdpkkkmckeripqpkntvamlnelrhgliyklesqtgpvhaplftisvevdgqkylgqg
rskkvarieaaatalrsfiqfkdgavlsplkpa

SCOPe Domain Coordinates for d2ljha_:

Click to download the PDB-style file with coordinates for d2ljha_.
(The format of our PDB-style files is described here.)

Timeline for d2ljha_: