Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Bacteroides vulgatus [TaxId:435590] [194549] (5 PDB entries) |
Domain d2ljaa1: 2lja A:4-144 [242901] Other proteins in same PDB: d2ljaa2, d2ljaa3 automated match to d4grfa_ |
PDB Entry: 2lja (more details)
SCOPe Domain Sequences for d2ljaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ljaa1 c.47.1.0 (A:4-144) automated matches {Bacteroides vulgatus [TaxId: 435590]} rsgnpsaasfsypdingktvsladlkgkyiyidvwatwcgpcrgelpalkeleekyagkd ihfvslscdknkkawenmvtkdqlkgiqlhmgtdrtfmdaylingiprfilldrdgkiis anmtrpsdpktaekfnellgl
Timeline for d2ljaa1: