Lineage for d2ljaa1 (2lja A:4-144)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2133978Species Bacteroides vulgatus [TaxId:435590] [194549] (5 PDB entries)
  8. 2133986Domain d2ljaa1: 2lja A:4-144 [242901]
    Other proteins in same PDB: d2ljaa2, d2ljaa3
    automated match to d4grfa_

Details for d2ljaa1

PDB Entry: 2lja (more details)

PDB Description: Solution Structure of a putative thiol-disulfide oxidoreductase from Bacteroides vulgatus
PDB Compounds: (A:) Putative thiol-disulfide oxidoreductase

SCOPe Domain Sequences for d2ljaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ljaa1 c.47.1.0 (A:4-144) automated matches {Bacteroides vulgatus [TaxId: 435590]}
rsgnpsaasfsypdingktvsladlkgkyiyidvwatwcgpcrgelpalkeleekyagkd
ihfvslscdknkkawenmvtkdqlkgiqlhmgtdrtfmdaylingiprfilldrdgkiis
anmtrpsdpktaekfnellgl

SCOPe Domain Coordinates for d2ljaa1:

Click to download the PDB-style file with coordinates for d2ljaa1.
(The format of our PDB-style files is described here.)

Timeline for d2ljaa1: