| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
| Protein automated matches [190971] (14 species) not a true protein |
| Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255441] (1 PDB entry) |
| Domain d2lj8a_: 2lj8 A: [242900] automated match to d2xfaa_ |
PDB Entry: 2lj8 (more details)
SCOPe Domain Sequences for d2lj8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lj8a_ d.109.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mamsgvsvadecvtalndlrhkksryvimhivdqksiavktigerganfdqfieaidknv
pcyaafdfeyttndgprdkliliswnpdsgaprtkmlysssrdalvpltqgfqgiqanda
sgldfeeisrkvksnr
Timeline for d2lj8a_: