SCOPe 2.07: Domain d2lj8a_: 2lj8 A:

Lineage for d2lj8a_ (2lj8 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families)

5. Family d.109.1.0: automated matches [191561] (1 protein)
   not a true family

6. Protein automated matches [190971] (14 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255441] (1 PDB entry)

8. Domain d2lj8a_: 2lj8 A: [242900]
   automated match to d2xfaa_

Details for d2lj8a_

PDB Entry: 2lj8

PDB Description: Solution structure of ADF/Cofilin from trypanosoma brucei

PDB Compounds: (A:) Cofilin/actin depolymerizing factor, putative

SCOPe Domain Sequences for d2lj8a_:

Sequence; same for both SEQRES and ATOM records:

>d2lj8a_ d.109.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mamsgvsvadecvtalndlrhkksryvimhivdqksiavktigerganfdqfieaidknv
pcyaafdfeyttndgprdkliliswnpdsgaprtkmlysssrdalvpltqgfqgiqanda
sgldfeeisrkvksnr

Timeline for d2lj8a_:

• d2lj8a_ first appeared in SCOPe 2.04
  
• d2lj8a_ appears in SCOPe 2.06
  
• d2lj8a_ appears in the current release, SCOPe 2.08