Lineage for d2lj4a_ (2lj4 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2186026Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2186027Protein automated matches [191162] (27 species)
    not a true protein
  7. 2186160Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255439] (1 PDB entry)
  8. 2186161Domain d2lj4a_: 2lj4 A: [242897]
    automated match to d1j6ya_

Details for d2lj4a_

PDB Entry: 2lj4 (more details)

PDB Description: solution structure of the tbpin1
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase/rotamase, putative

SCOPe Domain Sequences for d2lj4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lj4a_ d.26.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mseklraahllvkfsgsrnpvsrrtgdstadvtyedaikelqkwsqriasgevsfeeaas
qrsdcgsyasggdlgffssgemmkpfedavralkigdispivqtdsglhiikrla

SCOPe Domain Coordinates for d2lj4a_:

Click to download the PDB-style file with coordinates for d2lj4a_.
(The format of our PDB-style files is described here.)

Timeline for d2lj4a_: