SCOPe 2.06: Domain d2lj4a_: 2lj4 A:

Lineage for d2lj4a_ (2lj4 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (27 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [255439] (1 PDB entry)

8. Domain d2lj4a_: 2lj4 A: [242897]
   automated match to d1j6ya_

Details for d2lj4a_

PDB Entry: 2lj4

PDB Description: solution structure of the tbpin1

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase/rotamase, putative

SCOPe Domain Sequences for d2lj4a_:

Sequence; same for both SEQRES and ATOM records:

>d2lj4a_ d.26.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
mseklraahllvkfsgsrnpvsrrtgdstadvtyedaikelqkwsqriasgevsfeeaas
qrsdcgsyasggdlgffssgemmkpfedavralkigdispivqtdsglhiikrla

Timeline for d2lj4a_:

• d2lj4a_ first appeared in SCOPe 2.04
  
• d2lj4a_ appears in SCOPe 2.05
  
• d2lj4a_ appears in SCOPe 2.07
  
• d2lj4a_ appears in the current release, SCOPe 2.08