Lineage for d2li7a_ (2li7 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582033Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2582034Family g.3.7.1: Long-chain scorpion toxins [57096] (5 proteins)
  6. 2582123Protein automated matches [190485] (8 species)
    not a true protein
  7. 2582124Species Centruroides suffusus [TaxId:6881] [255438] (2 PDB entries)
  8. 2582125Domain d2li7a_: 2li7 A: [242892]
    automated match to d2ybri_

Details for d2li7a_

PDB Entry: 2li7 (more details)

PDB Description: Solution Structure of CssII
PDB Compounds: (A:) Beta-mammal toxin Css2

SCOPe Domain Sequences for d2li7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2li7a_ g.3.7.1 (A:) automated matches {Centruroides suffusus [TaxId: 6881]}
kegylvskstgckyeclklgdndyclreckqqygkssggycyafacwcthlyeqavvwpl
pnktcn

SCOPe Domain Coordinates for d2li7a_:

Click to download the PDB-style file with coordinates for d2li7a_.
(The format of our PDB-style files is described here.)

Timeline for d2li7a_: