Lineage for d2li6a_ (2li6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692925Superfamily a.4.3: ARID-like [46774] (2 families) (S)
    contains extra helices at both N- and C-termini
  5. 2692926Family a.4.3.1: ARID domain [46775] (5 proteins)
  6. 2692942Protein automated matches [190579] (2 species)
    not a true protein
  7. 2692943Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [255437] (1 PDB entry)
  8. 2692944Domain d2li6a_: 2li6 A: [242891]
    automated match to d1kkxa_

Details for d2li6a_

PDB Entry: 2li6 (more details)

PDB Description: 1H, 13C, and 15N Chemical Shift Assignments for yeast protein
PDB Compounds: (A:) SWI/SNF chromatin-remodeling complex subunit SWI1

SCOPe Domain Sequences for d2li6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2li6a_ a.4.3.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qslnpalqekistelnnkqyelfmkslienckkrnmplqsipeignrkinlfylymlvqk
fggadqvtrtqqwsmvaqrlqisdyqqlesiyfrillpyerhmisqegiketqakr

SCOPe Domain Coordinates for d2li6a_:

Click to download the PDB-style file with coordinates for d2li6a_.
(The format of our PDB-style files is described here.)

Timeline for d2li6a_: