Lineage for d4celb_ (4cel B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389601Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2389602Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)
  7. 2389635Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (22 PDB entries)
  8. 2389654Domain d4celb_: 4cel B: [24289]
    complexed with ca, nag; mutant

Details for d4celb_

PDB Entry: 4cel (more details), 2.2 Å

PDB Description: active-site mutant d214n determined at ph 6.0 with no ligand bound in the active site
PDB Compounds: (B:) 1,4-beta-d-glucan cellobiohydrolase I

SCOPe Domain Sequences for d4celb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4celb_ b.29.1.10 (B:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemniweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOPe Domain Coordinates for d4celb_:

Click to download the PDB-style file with coordinates for d4celb_.
(The format of our PDB-style files is described here.)

Timeline for d4celb_: