SCOPe 2.04: Domain d2lhja_: 2lhj A:

Lineage for d2lhja_ (2lhj A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.0: automated matches [191668] (1 protein)
   not a true family

6. Protein automated matches [191268] (4 species)
   not a true protein

7. Species Babesia bovis [TaxId:5865] [255435] (1 PDB entry)

8. Domain d2lhja_: 2lhj A: [242886]
   automated match to d1aaba_

Details for d2lhja_

PDB Entry: 2lhj

PDB Description: NMR structure of the high mobility group protein-like protein NHP1 from Babesia bovis T2Bo (BaboA.00841.a)

PDB Compounds: (A:) High mobility group protein homolog NHP1

SCOPe Domain Sequences for d2lhja_:

Sequence; same for both SEQRES and ATOM records:

>d2lhja_ a.21.1.0 (A:) automated matches {Babesia bovis [TaxId: 5865]}
magasdrtgvrrprkakkdpnapkralssymffakekrveiiaenpeiakdvaaigkmig
aawnalsdeekkpyermsdedrvryerekaeyaqrkv

Timeline for d2lhja_:

• d2lhja_ is new in SCOPe 2.04-stable
  
• d2lhja_ appears in SCOPe 2.05
  
• d2lhja_ appears in the current release, SCOPe 2.08