Lineage for d2lhja_ (2lhj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2698036Family a.21.1.0: automated matches [191668] (1 protein)
    not a true family
  6. 2698037Protein automated matches [191268] (4 species)
    not a true protein
  7. 2698038Species Babesia bovis [TaxId:5865] [255435] (1 PDB entry)
  8. 2698039Domain d2lhja_: 2lhj A: [242886]
    automated match to d1aaba_

Details for d2lhja_

PDB Entry: 2lhj (more details)

PDB Description: NMR structure of the high mobility group protein-like protein NHP1 from Babesia bovis T2Bo (BaboA.00841.a)
PDB Compounds: (A:) High mobility group protein homolog NHP1

SCOPe Domain Sequences for d2lhja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lhja_ a.21.1.0 (A:) automated matches {Babesia bovis [TaxId: 5865]}
magasdrtgvrrprkakkdpnapkralssymffakekrveiiaenpeiakdvaaigkmig
aawnalsdeekkpyermsdedrvryerekaeyaqrkv

SCOPe Domain Coordinates for d2lhja_:

Click to download the PDB-style file with coordinates for d2lhja_.
(The format of our PDB-style files is described here.)

Timeline for d2lhja_: