![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
![]() | Family a.21.1.0: automated matches [191668] (1 protein) not a true family |
![]() | Protein automated matches [191268] (4 species) not a true protein |
![]() | Species Babesia bovis [TaxId:5865] [255435] (1 PDB entry) |
![]() | Domain d2lhja_: 2lhj A: [242886] automated match to d1aaba_ |
PDB Entry: 2lhj (more details)
SCOPe Domain Sequences for d2lhja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lhja_ a.21.1.0 (A:) automated matches {Babesia bovis [TaxId: 5865]} magasdrtgvrrprkakkdpnapkralssymffakekrveiiaenpeiakdvaaigkmig aawnalsdeekkpyermsdedrvryerekaeyaqrkv
Timeline for d2lhja_: