SCOPe 2.07: Domain d2lhha1: 2lhh A:1-120

Lineage for d2lhha1 (2lhh A:1-120)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (22 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [255436] (1 PDB entry)

8. Domain d2lhha1: 2lhh A:1-120 [242885]
   Other proteins in same PDB: d2lhha2
   automated match to d2bkid_
   complexed with ca

Details for d2lhha1

PDB Entry: 2lhh

PDB Description: Solution structure of Ca2+-bound yCaM

PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2lhha1:

Sequence; same for both SEQRES and ATOM records:

>d2lhha1 a.39.1.5 (A:1-120) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
hqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdae

Timeline for d2lhha1:

• d2lhha1 first appeared in SCOPe 2.04, called d2lhha_
  
• d2lhha1 appears in SCOPe 2.06