![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (12 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
![]() | Protein Calmodulin [47516] (13 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [368931] (2 PDB entries) |
![]() | Domain d2lhha1: 2lhh A:1-120 [242885] Other proteins in same PDB: d2lhha2 automated match to d2bkid_ complexed with ca |
PDB Entry: 2lhh (more details)
SCOPe Domain Sequences for d2lhha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lhha1 a.39.1.5 (A:1-120) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn hqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdae
Timeline for d2lhha1: