Lineage for d2lhha1 (2lhh A:1-120)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2710608Protein Calmodulin [47516] (13 species)
  7. 2710639Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [368931] (2 PDB entries)
  8. 2710642Domain d2lhha1: 2lhh A:1-120 [242885]
    Other proteins in same PDB: d2lhha2
    automated match to d2bkid_
    complexed with ca

Details for d2lhha1

PDB Entry: 2lhh (more details)

PDB Description: Solution structure of Ca2+-bound yCaM
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2lhha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lhha1 a.39.1.5 (A:1-120) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ssnlteeqiaefkeafalfdkdnngsissselatvmrslglspseaevndlmneidvdgn
hqiefseflalmsrqlksndseqelleafkvfdkngdglisaaelkhvltsigekltdae

SCOPe Domain Coordinates for d2lhha1:

Click to download the PDB-style file with coordinates for d2lhha1.
(The format of our PDB-style files is described here.)

Timeline for d2lhha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lhha2