Lineage for d2lhda_ (2lhd A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934642Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2934643Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2934772Protein automated matches [190067] (6 species)
    not a true protein
  7. 2934773Species Artificial gene [TaxId:32630] [255434] (4 PDB entries)
  8. 2934777Domain d2lhda_: 2lhd A: [242882]
    automated match to d2igga_

Details for d2lhda_

PDB Entry: 2lhd (more details)

PDB Description: GB98 solution structure
PDB Compounds: (A:) gb98

SCOPe Domain Sequences for d2lhda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lhda_ d.15.7.1 (A:) automated matches {Artificial gene [TaxId: 32630]}
ttyklilnlkqakeeaikelvdagtaekyfklianaktvegvwtykdeiktftvte

SCOPe Domain Coordinates for d2lhda_:

Click to download the PDB-style file with coordinates for d2lhda_.
(The format of our PDB-style files is described here.)

Timeline for d2lhda_: