Lineage for d2lhaa_ (2lha A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772956Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2772982Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2772983Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries)
  8. 2772998Domain d2lhaa_: 2lha A: [242880]
    automated match to d2yoab_
    complexed with ihp

Details for d2lhaa_

PDB Entry: 2lha (more details)

PDB Description: solution structure of c2b with ip6
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d2lhaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lhaa_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamlavkk

SCOPe Domain Coordinates for d2lhaa_:

Click to download the PDB-style file with coordinates for d2lhaa_.
(The format of our PDB-style files is described here.)

Timeline for d2lhaa_: