SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2lhaa_ (2lha A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2038038Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2038039Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 2038183Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 protein domains)
    topologically similar to the C-terminal domain of PapD
  6. 2038208Protein Synaptogamin I [49576] (3 species)
    duplication: contains tandem repeat of two similar domains
  7. 2038209Species Human (Homo sapiens) [TaxId:9606] [158946] (10 PDB entries)
  8. 2038220Domain d2lhaa_: 2lha A: [242880]
    automated match to d2yoab_
    complexed with ihp

Details for d2lhaa_

PDB Entry: 2lha (more details)

PDB Description: solution structure of c2b with ip6
PDB Compounds: (A:) Synaptotagmin-1

SCOPe Domain Sequences for d2lhaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lhaa_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamlavkk

SCOPe Domain Coordinates for d2lhaa_:

Click to download the PDB-style file with coordinates for d2lhaa_.
(The format of our PDB-style files is described here.)

Timeline for d2lhaa_: