| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
| Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
| Protein Synaptogamin I [49576] (3 species) duplication: contains tandem repeat of two similar domains |
| Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries) |
| Domain d2lhaa_: 2lha A: [242880] automated match to d2yoab_ complexed with ihp |
PDB Entry: 2lha (more details)
SCOPe Domain Sequences for d2lhaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lhaa_ b.7.1.2 (A:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamlavkk
Timeline for d2lhaa_: