Lineage for d2lfoa_ (2lfo A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1800288Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 1800490Protein Liver fatty acid binding protein [50866] (3 species)
  7. 1800491Species Chicken (Gallus gallus) [TaxId:9031] [256386] (3 PDB entries)
  8. 1800493Domain d2lfoa_: 2lfo A: [242872]
    automated match to d3js1a_
    complexed with cho, gch

Details for d2lfoa_

PDB Entry: 2lfo (more details)

PDB Description: NMR structure of cl-BABP/SS complexed with glycochenodeoxycholic and glycocholic acids
PDB Compounds: (A:) Fatty acid-binding protein, liver

SCOPe Domain Sequences for d2lfoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lfoa_ b.60.1.2 (A:) Liver fatty acid binding protein {Chicken (Gallus gallus) [TaxId: 9031]}
afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
sftlgkeadittmdgkklkctvhlangklvcksekfsheqevkgnemvetitfggvtlir
rskrv

SCOPe Domain Coordinates for d2lfoa_:

Click to download the PDB-style file with coordinates for d2lfoa_.
(The format of our PDB-style files is described here.)

Timeline for d2lfoa_: