SCOPe 2.08: Domain d3cela_: 3cel A:

Lineage for d3cela_ (3cel A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)

7. Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (22 PDB entries)

8. Domain d3cela_: 3cel A: [24287]
   complexed with cd, nag; mutant

Details for d3cela_

PDB Entry: 3cel, 2 Å

PDB Description: active-site mutant e212q determined at ph 6.0 with cellobiose bound in the active site

PDB Compounds: (A:) 1,4-beta-d-glucan cellobiohydrolase I

SCOPe Domain Sequences for d3cela_:

Sequence; same for both SEQRES and ATOM records:

>d3cela_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsqmdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

Timeline for d3cela_:

• d3cela_ first appeared (with stable ids) in SCOP 1.55, called d3cel__
  
• d3cela_ appears in SCOPe 2.07