SCOPe 2.05: Domain d2lfja_: 2lfj A:

Lineage for d2lfja_ (2lfj A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Seminal ribonucleasease [54086] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54087] (17 PDB entries)
   Uniprot P00669 27-150

8. Domain d2lfja_: 2lfj A: [242869]
   automated match to d1y94a_

Details for d2lfja_

PDB Entry: 2lfj

PDB Description: Solution structure of the monomeric derivative of BS-RNase

PDB Compounds: (A:) Seminal ribonuclease

SCOPe Domain Sequences for d2lfja_:

Sequence; same for both SEQRES and ATOM records:

>d2lfja_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

Timeline for d2lfja_:

• d2lfja_ first appeared in SCOPe 2.04
  
• d2lfja_ appears in SCOPe 2.06
  
• d2lfja_ appears in the current release, SCOPe 2.08