SCOPe 2.06: Domain d2lf4a2: 2lf4 A:148-231

Lineage for d2lf4a2 (2lf4 A:148-231)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (10 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (8 PDB entries)

8. Domain d2lf4a2: 2lf4 A:148-231 [242867]
   Other proteins in same PDB: d2lf4a1
   automated match to d3ntea2
   mutant

Details for d2lf4a2

PDB Entry: 2lf4

PDB Description: Structure of a monomeric mutant of the HIV-1 capsid protein

PDB Compounds: (A:) gag polyprotein

SCOPe Domain Sequences for d2lf4a2:

Sequence; same for both SEQRES and ATOM records:

>d2lf4a2 a.28.3.0 (A:148-231) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqgvggpghkarvl

Timeline for d2lf4a2:

• d2lf4a2 first appeared in SCOPe 2.04
  
• d2lf4a2 appears in SCOPe 2.05
  
• d2lf4a2 appears in SCOPe 2.07
  
• d2lf4a2 appears in the current release, SCOPe 2.08