SCOPe 2.07: Domain d2lf2a1: 2lf2 A:1-167

Lineage for d2lf2a1 (2lf2 A:1-167)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (22 species)
   not a true protein

7. Species Cytophaga hutchinsonii [TaxId:269798] [255432] (1 PDB entry)

8. Domain d2lf2a1: 2lf2 A:1-167 [242865]
   Other proteins in same PDB: d2lf2a2
   automated match to d3uidb_

Details for d2lf2a1

PDB Entry: 2lf2

PDB Description: Solution NMR structure of the AHSA1-like protein CHU_1110 from Cytophaga hutchinsonii, Northeast Structural Genomics Consortium Target ChR152

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2lf2a1:

Sequence; same for both SEQRES and ATOM records:

>d2lf2a1 d.129.3.0 (A:1-167) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
mrtdlaldfsvnkenktitikrefaavraivweaftraeildqwwapkpwkaktksmdfk
eggtwlyamvgpngeehwsiceyaiikpierftgkdgftdasgklntemprsnwdmrfid
kgeitevqyhisyddvaqleatiqmgfkegitmamenldellvsgkk

Timeline for d2lf2a1:

• d2lf2a1 first appeared in SCOPe 2.04, called d2lf2a_
  
• d2lf2a1 appears in SCOPe 2.06
  
• d2lf2a1 appears in the current release, SCOPe 2.08