SCOPe 2.04: Domain d2lf1a_: 2lf1 A:

Lineage for d2lf1a_ (2lf1 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (8 species)

7. Species Lactobacillus casei [TaxId:1582] [53601] (10 PDB entries)

8. Domain d2lf1a_: 2lf1 A: [242864]
   automated match to d1disa_
   complexed with ndp

Details for d2lf1a_

PDB Entry: 2lf1

PDB Description: Solution structure of L. casei dihydrofolate reductase complexed with NADPH, 30 structures

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2lf1a_:

Sequence; same for both SEQRES and ATOM records:

>d2lf1a_ c.71.1.1 (A:) Dihydrofolate reductase, prokaryotic type {Lactobacillus casei [TaxId: 1582]}
taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka

Timeline for d2lf1a_:

• d2lf1a_ is new in SCOPe 2.04-stable
  
• d2lf1a_ appears in SCOPe 2.05
  
• d2lf1a_ appears in the current release, SCOPe 2.08