Lineage for d2leoa_ (2leo A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038555Family g.68.1.0: automated matches [254208] (1 protein)
    not a true family
  6. 3038556Protein automated matches [254463] (3 species)
    not a true protein
  7. 3038559Species Human (Homo sapiens) [TaxId:9606] [255304] (3 PDB entries)
  8. 3038561Domain d2leoa_: 2leo A: [242860]
    automated match to d1m8ca_

Details for d2leoa_

PDB Entry: 2leo (more details)

PDB Description: Solution structure of esophageal cancer-related gene 2
PDB Compounds: (A:) Serine protease inhibitor Kazal-type 7

SCOPe Domain Sequences for d2leoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2leoa_ g.68.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seaaslspkkvdcsiykkypvvaipcpitylpvcgsdyitygnechlcteslksngrvqf
lhdgsc

SCOPe Domain Coordinates for d2leoa_:

Click to download the PDB-style file with coordinates for d2leoa_.
(The format of our PDB-style files is described here.)

Timeline for d2leoa_: