![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
![]() | Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
![]() | Family g.68.1.0: automated matches [254208] (1 protein) not a true family |
![]() | Protein automated matches [254463] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255304] (3 PDB entries) |
![]() | Domain d2leoa_: 2leo A: [242860] automated match to d1m8ca_ |
PDB Entry: 2leo (more details)
SCOPe Domain Sequences for d2leoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2leoa_ g.68.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} seaaslspkkvdcsiykkypvvaipcpitylpvcgsdyitygnechlcteslksngrvqf lhdgsc
Timeline for d2leoa_: