SCOPe 2.05: Domain d2celb_: 2cel B:

Lineage for d2celb_ (2cel B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold
   automatically mapped to Pfam PF00840

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)

7. Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (20 PDB entries)

8. Domain d2celb_: 2cel B: [24286]
   complexed with ca, nag; mutant

Details for d2celb_

PDB Entry: 2cel, 2 Å

PDB Description: active-site mutant e212q determined at ph 6.0 with no ligand bound in the active site

PDB Compounds: (B:) 1,4-beta-d-glucan cellobiohydrolase I

SCOPe Domain Sequences for d2celb_:

Sequence; same for both SEQRES and ATOM records:

>d2celb_ b.29.1.10 (B:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A [TaxId: 51453]}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsqmdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

Timeline for d2celb_:

• d2celb_ first appeared (with stable ids) in SCOP 1.55
  
• d2celb_ appears in SCOPe 2.04
  
• d2celb_ appears in SCOPe 2.06
  
• d2celb_ appears in the current release, SCOPe 2.08