SCOPe 2.07: Domain d2le4a1: 2le4 A:2-81

Lineage for d2le4a1 (2le4 A:2-81)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein Sox-2 [81718] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101105] (3 PDB entries)

8. Domain d2le4a1: 2le4 A:2-81 [242853]
   Other proteins in same PDB: d2le4a2
   automated match to d1gt0d_

Details for d2le4a1

PDB Entry: 2le4

PDB Description: Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2

PDB Compounds: (A:) transcription factor sox-2

SCOPe Domain Sequences for d2le4a1:

Sequence; same for both SEQRES and ATOM records:

>d2le4a1 a.21.1.1 (A:2-81) Sox-2 {Human (Homo sapiens) [TaxId: 9606]}
drvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrlr
alhmkehpdykyrprrktkt

Timeline for d2le4a1:

• d2le4a1 first appeared in SCOPe 2.04, called d2le4a_
  
• d2le4a1 appears in SCOPe 2.06
  
• d2le4a1 appears in the current release, SCOPe 2.08