Lineage for d2le4a_ (2le4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725579Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 1725580Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 1725581Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 1725622Protein Sox-2 [81718] (2 species)
  7. 1725623Species Human (Homo sapiens) [TaxId:9606] [101105] (2 PDB entries)
  8. 1725625Domain d2le4a_: 2le4 A: [242853]
    automated match to d1gt0d_

Details for d2le4a_

PDB Entry: 2le4 (more details)

PDB Description: Solution structure of the HMG box DNA-binding domain of human stem cell transcription factor Sox2
PDB Compounds: (A:) transcription factor sox-2

SCOPe Domain Sequences for d2le4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2le4a_ a.21.1.1 (A:) Sox-2 {Human (Homo sapiens) [TaxId: 9606]}
sdrvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrl
ralhmkehpdykyrprrktkt

SCOPe Domain Coordinates for d2le4a_:

Click to download the PDB-style file with coordinates for d2le4a_.
(The format of our PDB-style files is described here.)

Timeline for d2le4a_: