SCOPe 2.08: Domain d2le1a1: 2le1 A:1-143

Lineage for d2le1a1 (2le1 A:1-143)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Thermobifida fusca [TaxId:269800] [255430] (1 PDB entry)

8. Domain d2le1a1: 2le1 A:1-143 [242852]
   Other proteins in same PDB: d2le1a2
   automated match to d3cnwa1

Details for d2le1a1

PDB Entry: 2le1

PDB Description: Solution NMR Structure of Tfu_2981 from Thermobifida fusca, Northeast Structural Genomics Consortium Target TfR85A

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2le1a1:

Sequence; same for both SEQRES and ATOM records:

>d2le1a1 d.129.3.0 (A:1-143) automated matches {Thermobifida fusca [TaxId: 269800]}
matlrrsvevaapaadvwtlvgdfsaihrwhpqvsaptlrgasphtpgaervfgagteee
lverlverdesarrlvytmpdppfpitnhravlevvprddrhctvvwtamfdcspetare
lesvigdgvfavglnalaerygr

Timeline for d2le1a1:

• d2le1a1 first appeared in SCOPe 2.04, called d2le1a_
  
• d2le1a1 appears in SCOPe 2.07