SCOPe 2.08: Domain d2ldua1: 2ldu A:12-125

Lineage for d2ldua1 (2ldu A:12-125)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
   automatically mapped to Pfam PF00447

6. Protein automated matches [254598] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255429] (7 PDB entries)

8. Domain d2ldua1: 2ldu A:12-125 [242851]
   Other proteins in same PDB: d2ldua2
   automated match to d1hksa_

Details for d2ldua1

PDB Entry: 2ldu

PDB Description: Solution NMR Structure of Heat shock factor protein 1 DNA binding domain from homo sapiens, Northeast Structural Genomics Consortium Target HR3023C

PDB Compounds: (A:) Heat shock factor protein 1

SCOPe Domain Sequences for d2ldua1:

Sequence; same for both SEQRES and ATOM records:

>d2ldua1 a.4.5.22 (A:12-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agpsnvpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasf
vrqlnmygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrkvtsvs

Timeline for d2ldua1:

• d2ldua1 first appeared in SCOPe 2.04, called d2ldua_
  
• d2ldua1 appears in SCOPe 2.07