Lineage for d2ldua1 (2ldu A:12-125)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693501Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
    automatically mapped to Pfam PF00447
  6. 2693521Protein automated matches [254598] (1 species)
    not a true protein
  7. 2693522Species Human (Homo sapiens) [TaxId:9606] [255429] (7 PDB entries)
  8. 2693543Domain d2ldua1: 2ldu A:12-125 [242851]
    Other proteins in same PDB: d2ldua2
    automated match to d1hksa_

Details for d2ldua1

PDB Entry: 2ldu (more details)

PDB Description: Solution NMR Structure of Heat shock factor protein 1 DNA binding domain from homo sapiens, Northeast Structural Genomics Consortium Target HR3023C
PDB Compounds: (A:) Heat shock factor protein 1

SCOPe Domain Sequences for d2ldua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ldua1 a.4.5.22 (A:12-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agpsnvpafltklwtlvsdpdtdalicwspsgnsfhvfdqgqfakevlpkyfkhnnmasf
vrqlnmygfrkvvhieqgglvkperddtefqhpcflrgqeqllenikrkvtsvs

SCOPe Domain Coordinates for d2ldua1:

Click to download the PDB-style file with coordinates for d2ldua1.
(The format of our PDB-style files is described here.)

Timeline for d2ldua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ldua2