Lineage for d2ldoa_ (2ldo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734165Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734166Superfamily a.138.1: Multiheme cytochromes [48695] (4 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 2734167Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)
  6. 2734224Protein Cytochrome c7 (cytochrome c551.5, PpcA) [48703] (3 species)
    contains three heme groups; deletion of one of Cyt c3 heme-binding sites
  7. 2734236Species Geobacter sulfurreducens, PpcA [TaxId:35554] [101502] (9 PDB entries)
  8. 2734244Domain d2ldoa_: 2ldo A: [242850]
    automated match to d1os6a_
    complexed with hec

Details for d2ldoa_

PDB Entry: 2ldo (more details)

PDB Description: solution structure of triheme cytochrome ppca from geobacter sulfurreducens reveals the structural origin of the redox-bohr effect
PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d2ldoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ldoa_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5, PpcA) {Geobacter sulfurreducens, PpcA [TaxId: 35554]}
addivlkakngdvkfphkahqkavpdckkchekgpgkiegfgkemahgkgckgcheemkk
gptkcgechkk

SCOPe Domain Coordinates for d2ldoa_:

Click to download the PDB-style file with coordinates for d2ldoa_.
(The format of our PDB-style files is described here.)

Timeline for d2ldoa_: