Lineage for d2ldia_ (2ldi A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1910055Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1910183Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 1910184Protein automated matches [191063] (7 species)
    not a true protein
  7. 1910205Species Synechocystis sp. [TaxId:1148] [255182] (3 PDB entries)
  8. 1910206Domain d2ldia_: 2ldi A: [242848]
    automated match to d2qifb_
    mutant

Details for d2ldia_

PDB Entry: 2ldi (more details)

PDB Description: nmr solution structure of ziaan sub mutant
PDB Compounds: (A:) Zinc-transporting ATPase

SCOPe Domain Sequences for d2ldia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ldia_ d.58.17.0 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
plktqqmqvggmrcaacassieralerlkgvaeasvtvatgrltvtydpkqvseitiqer
iaalgytlaep

SCOPe Domain Coordinates for d2ldia_:

Click to download the PDB-style file with coordinates for d2ldia_.
(The format of our PDB-style files is described here.)

Timeline for d2ldia_: