Lineage for d2ld5a_ (2ld5 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305405Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2305406Protein automated matches [190674] (22 species)
    not a true protein
  7. 2305483Species Mouse (Mus musculus) [TaxId:10090] [188321] (5 PDB entries)
  8. 2305493Domain d2ld5a_: 2ld5 A: [242847]
    automated match to d1nk2p_
    protein/DNA complex

Details for d2ld5a_

PDB Entry: 2ld5 (more details)

PDB Description: solution nmr-derived complex structure of hoxa13 dna binding domain bound to dna
PDB Compounds: (A:) Homeobox protein Hox-A13

SCOPe Domain Sequences for d2ld5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ld5a_ a.4.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grkkrvpytkvqlkelereyatnkfitkdkrrrisattnlserqvtiwfqnrrvkekkvi
nklktts

SCOPe Domain Coordinates for d2ld5a_:

Click to download the PDB-style file with coordinates for d2ld5a_.
(The format of our PDB-style files is described here.)

Timeline for d2ld5a_: