Lineage for d2lc7a_ (2lc7 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2379659Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2379660Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2379661Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2379973Protein automated matches [190055] (6 species)
    not a true protein
  7. 2379977Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255425] (2 PDB entries)
  8. 2379979Domain d2lc7a_: 2lc7 A: [242840]
    automated match to d1rzxa_

Details for d2lc7a_

PDB Entry: 2lc7 (more details)

PDB Description: Solution structure of the isolated Par-6 PDZ domain
PDB Compounds: (A:) Par-6

SCOPe Domain Sequences for d2lc7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lc7a_ b.36.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ethrrvrllkhgsdkplgfyirdgtsvrvtasglekqpgifisrlvpgglaestgllavn
devievngievagktldqvtdmmvanssnliitvkpanqr

SCOPe Domain Coordinates for d2lc7a_:

Click to download the PDB-style file with coordinates for d2lc7a_.
(The format of our PDB-style files is described here.)

Timeline for d2lc7a_: