SCOPe 2.06: Domain d2lc6a1: 2lc6 A:130-255

Lineage for d2lc6a1 (2lc6 A:130-255)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (7 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255425] (2 PDB entries)

8. Domain d2lc6a1: 2lc6 A:130-255 [242839]
   Other proteins in same PDB: d2lc6a2
   automated match to d1ry4a_

Details for d2lc6a1

PDB Entry: 2lc6

PDB Description: Solution structure of Par-6 Q144C/L164C

PDB Compounds: (A:) Par-6

SCOPe Domain Sequences for d2lc6a1:

Sequence; same for both SEQRES and ATOM records:

>d2lc6a1 b.36.1.1 (A:130-255) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ktkapsisiphdfrcvsaiidvdivpethrrvrlckhgsdkplgfyirdgtsvrvtasgl
ekqpgifisrlvpgglaestgllavndevievngievagktldqvtdmmvanssnliitv
kpanqr

Timeline for d2lc6a1:

• d2lc6a1 first appeared in SCOPe 2.04, called d2lc6a_
  
• d2lc6a1 was called d2lc6a_ in SCOPe 2.05
  
• d2lc6a1 appears in SCOPe 2.07
  
• d2lc6a1 appears in the current release, SCOPe 2.08