Lineage for d2lc5a_ (2lc5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711629Species Entamoeba histolytica [TaxId:294381] [255426] (2 PDB entries)
  8. 2711631Domain d2lc5a_: 2lc5 A: [242838]
    automated match to d1n0ya_
    complexed with ca

Details for d2lc5a_

PDB Entry: 2lc5 (more details)

PDB Description: calmodulin-like protein from entamoeba histolytica: solution structure and calcium-binding properties of a partially folded protein
PDB Compounds: (A:) Calmodulin, putative

SCOPe Domain Sequences for d2lc5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lc5a_ a.39.1.0 (A:) automated matches {Entamoeba histolytica [TaxId: 294381]}
mseqkkvltaeeqqeykeafqlfdkdndnkltaeelgtvmralganptkqkiseivkdyd
kdnsgkfdqetfltimleygqevds

SCOPe Domain Coordinates for d2lc5a_:

Click to download the PDB-style file with coordinates for d2lc5a_.
(The format of our PDB-style files is described here.)

Timeline for d2lc5a_: