Lineage for d2lc1a_ (2lc1 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779760Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1779761Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1779881Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 1779882Protein automated matches [191125] (7 species)
    not a true protein
  7. 1779905Species Mycobacterium tuberculosis [TaxId:83332] [255424] (1 PDB entry)
  8. 1779906Domain d2lc1a_: 2lc1 A: [242837]
    automated match to d3po8a_

Details for d2lc1a_

PDB Entry: 2lc1 (more details)

PDB Description: Rv0020c_FHA Structure
PDB Compounds: (A:) Putative uncharacterized protein TB39.8

SCOPe Domain Sequences for d2lc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lc1a_ b.26.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
ghgsagtsvtlqlddgsgrtyqlregsniigrgqdaqfrlpdtgvsrrhleirwdgqval
ladlnstngttvnnapvqewqladgdvirlghseiivrmh

SCOPe Domain Coordinates for d2lc1a_:

Click to download the PDB-style file with coordinates for d2lc1a_.
(The format of our PDB-style files is described here.)

Timeline for d2lc1a_: