SCOPe 2.06: Domain d2lbsb1: 2lbs B:366-453

Lineage for d2lbsb1 (2lbs B:366-453)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families)

5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
   Pfam PF00035

6. Protein automated matches [191157] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255423] (1 PDB entry)

8. Domain d2lbsb1: 2lbs B:366-453 [242835]
   Other proteins in same PDB: d2lbsb2
   automated match to d1t4lb_
   protein/RNA complex

Details for d2lbsb1

PDB Entry: 2lbs

PDB Description: Solution structure of double-stranded RNA binding domain of S. cerevisiae RNase III (Rnt1p) in complex with AAGU tetraloop hairpin

PDB Compounds: (B:) Ribonuclease 3

SCOPe Domain Sequences for d2lbsb1:

Sequence; same for both SEQRES and ATOM records:

>d2lbsb1 d.50.1.1 (B:366-453) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldmnakrqlysligyaslrlhyvtvkkptavdpnsivecrvgdgtvlgtgvgrnikiagi
raaenalrdkkmldfyakqraaiprses

Timeline for d2lbsb1:

• d2lbsb1 first appeared in SCOPe 2.04, called d2lbsb_
  
• d2lbsb1 was called d2lbsb_ in SCOPe 2.05
  
• d2lbsb1 appears in SCOPe 2.07
  
• d2lbsb1 appears in the current release, SCOPe 2.08